Class a: All alpha proteins [46456] (284 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) |
Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
Protein Extracellular dodecameric hemoglobin (erythrocruorin), subunit III (globin C) [116756] (1 species) |
Species Common earthworm (Lumbricus terrestris) [TaxId:6398] [116757] (2 PDB entries) Uniprot P11069 20-168 |
Domain d1x9fg_: 1x9f G: [114989] Other proteins in same PDB: d1x9fa_, d1x9fb_, d1x9fd_, d1x9fe_, d1x9ff_, d1x9fh_, d1x9fi_, d1x9fj_, d1x9fl_ complexed with cmo, hem, po4 |
PDB Entry: 1x9f (more details), 2.6 Å
SCOPe Domain Sequences for d1x9fg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1x9fg_ a.1.1.2 (G:) Extracellular dodecameric hemoglobin (erythrocruorin), subunit III (globin C) {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} hehccseedhrivqkqwdilwrdtesskikigfgrllltklakdipevndlfkrvdieha egpkfsahalrilngldlainllddppaldaaldhlahqhevregvqkahfkkfgeilat glpqvlddydalawksclkgiltkissrl
Timeline for d1x9fg_: