Lineage for d1x9ff_ (1x9f F:)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 631651Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 631652Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 631691Family a.1.1.2: Globins [46463] (26 proteins)
    Heme-binding protein
  6. 631744Protein Extracellular dodecameric hemoglobin (erythrocruorin), subunit II (globin B) [116754] (1 species)
  7. 631745Species Common earthworm (Lumbricus terrestris) [TaxId:6398] [116755] (2 PDB entries)
  8. 631747Domain d1x9ff_: 1x9f F: [114988]
    Other proteins in same PDB: d1x9fa_, d1x9fc_, d1x9fd_, d1x9fe_, d1x9fg_, d1x9fh_, d1x9fi_, d1x9fk_, d1x9fl_

Details for d1x9ff_

PDB Entry: 1x9f (more details), 2.6 Å

PDB Description: hemoglobin dodecamer from lumbricus erythrocruorin
PDB Compounds: (F:) Globin II, extracellular

SCOP Domain Sequences for d1x9ff_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x9ff_ a.1.1.2 (F:) Extracellular dodecameric hemoglobin (erythrocruorin), subunit II (globin B) {Common earthworm (Lumbricus terrestris) [TaxId: 6398]}
kkqcgvleglkvksewgraygsghdreafsqaiwratfaqvpesrslfkrvhgddtshpa
fiahadrvlggldiaistldqpatlkeeldhlqvqhegrkipdnyfdafktailhvvaaq
lgrcydreawdacidhiedgikghh

SCOP Domain Coordinates for d1x9ff_:

Click to download the PDB-style file with coordinates for d1x9ff_.
(The format of our PDB-style files is described here.)

Timeline for d1x9ff_: