Lineage for d1x9fd_ (1x9f D:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 758333Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 758334Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 758373Family a.1.1.2: Globins [46463] (26 proteins)
    Heme-binding protein
  6. 758420Protein Extracellular dodecameric hemoglobin (erythrocruorin), subunit D1 [116758] (1 species)
  7. 758421Species Common earthworm (Lumbricus terrestris) [TaxId:6398] [116759] (2 PDB entries)
    Uniprot O61233 19-158
  8. 758422Domain d1x9fd_: 1x9f D: [114986]
    Other proteins in same PDB: d1x9fa_, d1x9fb_, d1x9fc_, d1x9fe_, d1x9ff_, d1x9fg_, d1x9fi_, d1x9fj_, d1x9fk_

Details for d1x9fd_

PDB Entry: 1x9f (more details), 2.6 Å

PDB Description: hemoglobin dodecamer from lumbricus erythrocruorin
PDB Compounds: (D:) Hemoglobin chain d1

SCOP Domain Sequences for d1x9fd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x9fd_ a.1.1.2 (D:) Extracellular dodecameric hemoglobin (erythrocruorin), subunit D1 {Common earthworm (Lumbricus terrestris) [TaxId: 6398]}
eclvteslkvklqwasafghahervafglelwrdiiddhpeikapfsrvrgdniyspefg
ahsqrvlsglditismldtpdmlaaqlahlkvqhvernlkpeffdiflkhllhvlgdrlg
thfdfgawhdcvdqiidgik

SCOP Domain Coordinates for d1x9fd_:

Click to download the PDB-style file with coordinates for d1x9fd_.
(The format of our PDB-style files is described here.)

Timeline for d1x9fd_: