Lineage for d1x9fa_ (1x9f A:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 530467Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 530468Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 530506Family a.1.1.2: Globins [46463] (26 proteins)
    Heme-binding protein
  6. 530566Protein Extracellular dodecameric hemoglobin (erythrocruorin), subunit IV (globin A) [116752] (1 species)
  7. 530567Species Common earthworm (Lumbricus terrestris) [TaxId:6398] [116753] (1 PDB entry)
  8. 530568Domain d1x9fa_: 1x9f A: [114983]
    Other proteins in same PDB: d1x9fb_, d1x9fc_, d1x9fd_, d1x9ff_, d1x9fg_, d1x9fh_, d1x9fj_, d1x9fk_, d1x9fl_

Details for d1x9fa_

PDB Entry: 1x9f (more details), 2.6 Å

PDB Description: hemoglobin dodecamer from lumbricus erythrocruorin

SCOP Domain Sequences for d1x9fa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x9fa_ a.1.1.2 (A:) Extracellular dodecameric hemoglobin (erythrocruorin), subunit IV (globin A) {Common earthworm (Lumbricus terrestris)}
dccsyedrreirhiwddvwsssftdrrvaivravfddlfkhyptskalfervkidepesg
efkshlvrvanglkllinllddtlvlqshlghladqhiqrkgvtkeyfrgigeafarvlp
qvlscfnvdawnrcfhrlvariakdlp

SCOP Domain Coordinates for d1x9fa_:

Click to download the PDB-style file with coordinates for d1x9fa_.
(The format of our PDB-style files is described here.)

Timeline for d1x9fa_: