Class a: All alpha proteins [46456] (285 folds) |
Fold a.10: Protozoan pheromone-like [47013] (2 superfamilies) 3 helices; bundle, closed, left-handed twist, up-and-down |
Superfamily a.10.2: Hypothetical membrane protein Ta0354, soluble domain [116858] (1 family) automatically mapped to Pfam PF11433 |
Family a.10.2.1: Hypothetical membrane protein Ta0354, soluble domain [116859] (1 protein) |
Protein Hypothetical membrane protein Ta0354, soluble domain [116860] (1 species) |
Species Thermoplasma acidophilum [TaxId:2303] [116861] (1 PDB entry) Uniprot Q9HL76 69-121 |
Domain d1x9ba_: 1x9b A: [114982] Structural genomics target |
PDB Entry: 1x9b (more details)
SCOPe Domain Sequences for d1x9ba_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1x9ba_ a.10.2.1 (A:) Hypothetical membrane protein Ta0354, soluble domain {Thermoplasma acidophilum [TaxId: 2303]} rnlsdrakfesminspsksvfvrnlnelealavrlgksyriqldqakekwkvk
Timeline for d1x9ba_: