SCOPe 2.04: Domain d1x9ba_: 1x9b A:

Lineage for d1x9ba_ (1x9b A:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.10: Protozoan pheromone-like [47013] (2 superfamilies)
   3 helices; bundle, closed, left-handed twist, up-and-down

4. Superfamily a.10.2: Hypothetical membrane protein Ta0354, soluble domain [116858] (1 family)
   automatically mapped to Pfam PF11433

5. Family a.10.2.1: Hypothetical membrane protein Ta0354, soluble domain [116859] (1 protein)

6. Protein Hypothetical membrane protein Ta0354, soluble domain [116860] (1 species)

7. Species Thermoplasma acidophilum [TaxId:2303] [116861] (1 PDB entry)
   Uniprot Q9HL76 69-121

8. Domain d1x9ba_: 1x9b A: [114982]
   Structural genomics target

Details for d1x9ba_

PDB Entry: 1x9b

PDB Description: solution nmr structure of protein ta0354 from thermoplasma acidophilum. ontario center for structural proteomics target ta0354_69_121; northeast structural genomics consortium target tat38.

PDB Compounds: (A:) hypothetical membrane protein ta0354_69_121

SCOPe Domain Sequences for d1x9ba_:

Sequence; same for both SEQRES and ATOM records:

>d1x9ba_ a.10.2.1 (A:) Hypothetical membrane protein Ta0354, soluble domain {Thermoplasma acidophilum [TaxId: 2303]}
rnlsdrakfesminspsksvfvrnlnelealavrlgksyriqldqakekwkvk

Timeline for d1x9ba_:

• d1x9ba_ first appeared in SCOP 1.71
  
• d1x9ba_ appears in SCOPe 2.03
  
• d1x9ba_ appears in SCOPe 2.05
  
• d1x9ba_ appears in the current release, SCOPe 2.08