Lineage for d1x9ba_ (1x9b A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2697401Fold a.10: Protozoan pheromone-like [47013] (2 superfamilies)
    3 helices; bundle, closed, left-handed twist, up-and-down
  4. 2697421Superfamily a.10.2: Hypothetical membrane protein Ta0354, soluble domain [116858] (1 family) (S)
    automatically mapped to Pfam PF11433
  5. 2697422Family a.10.2.1: Hypothetical membrane protein Ta0354, soluble domain [116859] (1 protein)
  6. 2697423Protein Hypothetical membrane protein Ta0354, soluble domain [116860] (1 species)
  7. 2697424Species Thermoplasma acidophilum [TaxId:2303] [116861] (1 PDB entry)
    Uniprot Q9HL76 69-121
  8. 2697425Domain d1x9ba_: 1x9b A: [114982]
    Structural genomics target

Details for d1x9ba_

PDB Entry: 1x9b (more details)

PDB Description: solution nmr structure of protein ta0354 from thermoplasma acidophilum. ontario center for structural proteomics target ta0354_69_121; northeast structural genomics consortium target tat38.
PDB Compounds: (A:) hypothetical membrane protein ta0354_69_121

SCOPe Domain Sequences for d1x9ba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x9ba_ a.10.2.1 (A:) Hypothetical membrane protein Ta0354, soluble domain {Thermoplasma acidophilum [TaxId: 2303]}
rnlsdrakfesminspsksvfvrnlnelealavrlgksyriqldqakekwkvk

SCOPe Domain Coordinates for d1x9ba_:

Click to download the PDB-style file with coordinates for d1x9ba_.
(The format of our PDB-style files is described here.)

Timeline for d1x9ba_: