Lineage for d1x9ab_ (1x9a B:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1884580Fold c.114: DsrEFH-like [75168] (1 superfamily)
    3 layers: a/b/a, core: parallel beta-sheet of 5 strands, order 43215
  4. 1884581Superfamily c.114.1: DsrEFH-like [75169] (3 families) (S)
  5. 1884622Family c.114.1.2: DsrH-like [117489] (3 proteins)
    Pfam PF04077
  6. 1884632Protein Hypothetical protein TM0979 [117490] (1 species)
  7. 1884633Species Thermotoga maritima [TaxId:2336] [117491] (2 PDB entries)
    Uniprot Q9X074
  8. 1884635Domain d1x9ab_: 1x9a B: [114981]
    Structural genomics target

Details for d1x9ab_

PDB Entry: 1x9a (more details)

PDB Description: solution nmr structure of protein tm0979 from thermotoga maritima. ontario center for structural proteomics target tm0979_1_87; northeast structural genomics consortium target vt98.
PDB Compounds: (B:) hypothetical protein TM0979

SCOPe Domain Sequences for d1x9ab_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x9ab_ c.114.1.2 (B:) Hypothetical protein TM0979 {Thermotoga maritima [TaxId: 2336]}
malvlvkygtdhpveklkirsakaedkivliqngvfwaleeletpakvyaikddflargy
seedskvplitysefidllegeekfig

SCOPe Domain Coordinates for d1x9ab_:

Click to download the PDB-style file with coordinates for d1x9ab_.
(The format of our PDB-style files is described here.)

Timeline for d1x9ab_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1x9aa_