SCOPe 2.08: Domain d1x9ab_: 1x9a B:

Lineage for d1x9ab_ (1x9a B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.114: DsrEFH-like [75168] (1 superfamily)
   3 layers: a/b/a, core: parallel beta-sheet of 5 strands, order 43215

4. Superfamily c.114.1: DsrEFH-like [75169] (3 families)

5. Family c.114.1.2: DsrH-like [117489] (3 proteins)
   Pfam PF04077

6. Protein Hypothetical protein TM0979 [117490] (1 species)

7. Species Thermotoga maritima [TaxId:2336] [117491] (2 PDB entries)
   Uniprot Q9X074

8. Domain d1x9ab_: 1x9a B: [114981]
   Structural genomics target

Details for d1x9ab_

PDB Entry: 1x9a

PDB Description: solution nmr structure of protein tm0979 from thermotoga maritima. ontario center for structural proteomics target tm0979_1_87; northeast structural genomics consortium target vt98.

PDB Compounds: (B:) hypothetical protein TM0979

SCOPe Domain Sequences for d1x9ab_:

Sequence; same for both SEQRES and ATOM records:

>d1x9ab_ c.114.1.2 (B:) Hypothetical protein TM0979 {Thermotoga maritima [TaxId: 2336]}
malvlvkygtdhpveklkirsakaedkivliqngvfwaleeletpakvyaikddflargy
seedskvplitysefidllegeekfig

Timeline for d1x9ab_:

• d1x9ab_ first appeared in SCOP 1.71
  
• d1x9ab_ appears in SCOPe 2.07