Lineage for d1x9aa_ (1x9a A:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 594948Fold c.114: DsrEFH-like [75168] (1 superfamily)
    3 layers: a/b/a, core: parallel beta-sheet of 5 strands, order 43215
  4. 594949Superfamily c.114.1: DsrEFH-like [75169] (2 families) (S)
  5. 594962Family c.114.1.2: DsrH-like [117489] (1 protein)
    Pfam 04077
  6. 594963Protein Hypothetical protein TM0979 [117490] (1 species)
  7. 594964Species Thermotoga maritima [TaxId:243274] [117491] (2 PDB entries)
  8. 594965Domain d1x9aa_: 1x9a A: [114980]

Details for d1x9aa_

PDB Entry: 1x9a (more details)

PDB Description: solution nmr structure of protein tm0979 from thermotoga maritima. ontario center for structural proteomics target tm0979_1_87; northeast structural genomics consortium target vt98.

SCOP Domain Sequences for d1x9aa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x9aa_ c.114.1.2 (A:) Hypothetical protein TM0979 {Thermotoga maritima}
malvlvkygtdhpveklkirsakaedkivliqngvfwaleeletpakvyaikddflargy
seedskvplitysefidllegeekfig

SCOP Domain Coordinates for d1x9aa_:

Click to download the PDB-style file with coordinates for d1x9aa_.
(The format of our PDB-style files is described here.)

Timeline for d1x9aa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1x9ab_