SCOPe 2.01: Domain d1x99a_: 1x99 A:

Lineage for d1x99a_ (1x99 A:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.97: Cytolysin/lectin [63723] (1 superfamily)
   sandwich, 10 strands in 2 sheets;

4. Superfamily b.97.1: Cytolysin/lectin [63724] (2 families)
   some topological similarity to osmotin

5. Family b.97.1.2: Fungal fruit body lectin [117119] (3 proteins)
   Pfam PF07367

6. Protein Lectin xcl [117120] (1 species)

7. Species Xerocomus chrysenteron [TaxId:5386] [117121] (1 PDB entry)
   Uniprot Q8WZC9

8. Domain d1x99a_: 1x99 A: [114978]
   complexed with edo, so4

Details for d1x99a_

PDB Entry: 1x99, 1.4 Å

PDB Description: x-ray crystal structure of xerocomus chrysenteron lectin xcl at 1.4 angstroms resolution, mutated at q46m, v54m, l58m

PDB Compounds: (A:) lectin

SCOPe Domain Sequences for d1x99a_:

Sequence; same for both SEQRES and ATOM records:

>d1x99a_ b.97.1.2 (A:) Lectin xcl {Xerocomus chrysenteron [TaxId: 5386]}
ghmsysitlrvyqtnrdrgyfsivektvwhfanggtwseangahtltmggsgtsgmlrfm
stkgeritvavgvhnykrwcdvvtglkpdetalvinpqyynnggrdyvrekqlaeysvts
aigtkvevvytvaegnnleanvifs

Timeline for d1x99a_:

• d1x99a_ first appeared in SCOP 1.71
  
• d1x99a_ appears in SCOP 1.75
  
• d1x99a_ appears in SCOPe 2.02
  
• d1x99a_ appears in the current release, SCOPe 2.08, called d1x99a1