Lineage for d1x99a_ (1x99 A:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 568779Fold b.97: Cytolysin/lectin [63723] (1 superfamily)
    sandwich, 10 strands in 2 sheets;
  4. 568780Superfamily b.97.1: Cytolysin/lectin [63724] (2 families) (S)
    some topological similarity to osmotin
  5. 568796Family b.97.1.2: Fungal fruit body lectin [117119] (2 proteins)
    Pfam 07367
  6. 568797Protein Lectin xcl [117120] (1 species)
  7. 568798Species Xerocomus chrysenteron [TaxId:5386] [117121] (1 PDB entry)
  8. 568799Domain d1x99a_: 1x99 A: [114978]

Details for d1x99a_

PDB Entry: 1x99 (more details), 1.4 Å

PDB Description: X-ray crystal structure of Xerocomus chrysenteron lectin XCL at 1.4 Angstroms resolution, mutated at Q46M, V54M, L58M

SCOP Domain Sequences for d1x99a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x99a_ b.97.1.2 (A:) Lectin xcl {Xerocomus chrysenteron}
ghmsysitlrvyqtnrdrgyfsivektvwhfanggtwseangahtltmggsgtsgmlrfm
stkgeritvavgvhnykrwcdvvtglkpdetalvinpqyynnggrdyvrekqlaeysvts
aigtkvevvytvaegnnleanvifs

SCOP Domain Coordinates for d1x99a_:

Click to download the PDB-style file with coordinates for d1x99a_.
(The format of our PDB-style files is described here.)

Timeline for d1x99a_: