SCOP 1.73: Domain d1x92b_: 1x92 B:

Lineage for d1x92b_ (1x92 B:)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.80: SIS domain [53696] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 5 strands, order 21345

4. Superfamily c.80.1: SIS domain [53697] (3 families)

5. Family c.80.1.3: mono-SIS domain [69599] (5 proteins)
   dimer of mono-domain subunits

6. Protein Phosphoheptose isomerase GmhA1 [110723] (3 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [117729] (1 PDB entry)

8. Domain d1x92b_: 1x92 B: [114977]
   complexed with m7p

Details for d1x92b_

PDB Entry: 1x92, 2.3 Å

PDB Description: crystal structure of pseudomonas aeruginosa phosphoheptose isomerase in complex with reaction product d-glycero-d-mannopyranose-7- phosphate

PDB Compounds: (B:) Phosphoheptose isomerase

SCOP Domain Sequences for d1x92b_:

Sequence; same for both SEQRES and ATOM records:

>d1x92b_ c.80.1.3 (B:) Phosphoheptose isomerase GmhA1 {Pseudomonas aeruginosa [TaxId: 287]}
ghmdmqhrirqlfqasietkqqalevlppyieqaslvmvnallnegkilscgnggsagda
qhfssellnrfererpslpavalttdsstitsiandysynevfskqiralgqpgdvllai
stsgnsanviqaiqaahdremlvvaltgrdgggmaslllpedveirvpskitariqevhl
laihclcdlidrqlfgs

Timeline for d1x92b_:

• d1x92b_ first appeared in SCOP 1.71
  
• d1x92b_ appears in SCOP 1.75
  
• d1x92b_ appears in the current release, SCOPe 2.08, called d1x92b1