Lineage for d1x92a_ (1x92 A:)
- Root: SCOP 1.71
Class c: Alpha and beta proteins (a/b) [51349] (134 folds) 
Fold c.80: SIS domain [53696] (1 superfamily)
3 layers: a/b/a; parallel beta-sheet of 5 strands, order 21345Superfamily c.80.1: SIS domain [53697] (3 families) 
Family c.80.1.3: mono-SIS domain [69599] (5 proteins)
dimer of mono-domain subunits
Protein Phosphoheptose isomerase GmhA1 [110723] (3 species) 
Species Pseudomonas aeruginosa [TaxId:287] [117729] (1 PDB entry) 
Domain d1x92a_: 1x92 A: [114976]
Details for d1x92a_
PDB Entry: 1x92 (more details), 2.3 Å
PDB Description: crystal structure of pseudomonas aeruginosa phosphoheptose isomerase in complex with reaction product d-glycero-d-mannopyranose-7- phosphate
SCOP Domain Sequences for d1x92a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1x92a_ c.80.1.3 (A:) Phosphoheptose isomerase GmhA1 {Pseudomonas aeruginosa}
dmqhrirqlfqasietkqqalevlppyieqaslvmvnallnegkilscgnggsagdaqhf
ssellnrfererpslpavalttdsstitsiandysynevfskqiralgqpgdvllaists
gnsanviqaiqaahdremlvvaltgrdgggmaslllpedveirvpskitariqevhllai
hclcdlidrqlfgs
SCOP Domain Coordinates for d1x92a_:
Click to download the PDB-style file with coordinates for d1x92a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1x92a_:
- d1x92a_ is new in SCOP 1.71
- d1x92a_ appears in SCOP 1.73
- d1x92a_ appears in the current release, SCOPe 2.08
View in 3D
