Lineage for d1x8zc_ (1x8z C:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 536985Fold a.29: Bromodomain-like [47363] (6 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 537092Superfamily a.29.6: Plant invertase/pectin methylesterase inhibitor [101148] (1 family) (S)
    contains a short alpha-hairpin at the N-terminal extension
  5. 537093Family a.29.6.1: Plant invertase/pectin methylesterase inhibitor [101149] (2 proteins)
    Pfam 04043
  6. 537101Protein Pectin methylesterase inhibitor 1, PMEI1 [116887] (1 species)
    forms dimers and trimers by swapping the extra N-terminal hairpins
  7. 537102Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [116888] (3 PDB entries)
  8. 537108Domain d1x8zc_: 1x8z C: [114972]

Details for d1x8zc_

PDB Entry: 1x8z (more details), 2.86 Å

PDB Description: Crystal structure of a pectin methylesterase inhibitor from Arabidopsis thaliana

SCOP Domain Sequences for d1x8zc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x8zc_ a.29.6.1 (C:) Pectin methylesterase inhibitor 1, PMEI1 {Thale cress (Arabidopsis thaliana)}
dssemsticdktlnpsfclkflntkfaspnlqalakttldstqaratqtlkklqsiidgg
vdprsklayrscvdeyesaignleeafehlasgdgmgmnmkvsaaldgadtclddvkrlr
svdssvvnnsktiknlcgialvisnmlprn

SCOP Domain Coordinates for d1x8zc_:

Click to download the PDB-style file with coordinates for d1x8zc_.
(The format of our PDB-style files is described here.)

Timeline for d1x8zc_: