SCOPe 2.05: Domain d1x8zb_: 1x8z B:

Lineage for d1x8zb_ (1x8z B:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.6: Plant invertase/pectin methylesterase inhibitor [101148] (2 families)
   contains a short alpha-hairpin at the N-terminal extension

5. Family a.29.6.1: Plant invertase/pectin methylesterase inhibitor [101149] (3 proteins)
   Pfam PF04043

6. Protein Pectin methylesterase inhibitor 1, PMEI1 [116887] (1 species)
   forms dimers and trimers by swapping the extra N-terminal hairpins

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [116888] (3 PDB entries)
   Uniprot Q9LNF2 28-176

8. Domain d1x8zb_: 1x8z B: [114971]

Details for d1x8zb_

PDB Entry: 1x8z, 2.86 Å

PDB Description: Crystal structure of a pectin methylesterase inhibitor from Arabidopsis thaliana

PDB Compounds: (B:) invertase/pectin methylesterase inhibitor family protein

SCOPe Domain Sequences for d1x8zb_:

Sequence; same for both SEQRES and ATOM records:

>d1x8zb_ a.29.6.1 (B:) Pectin methylesterase inhibitor 1, PMEI1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
semsticdktlnpsfclkflntkfaspnlqalakttldstqaratqtlkklqsiidggvd
prsklayrscvdeyesaignleeafehlasgdgmgmnmkvsaaldgadtclddvkrlrsv
dssvvnnsktiknlcgialvisnmlpr

Timeline for d1x8zb_:

• d1x8zb_ first appeared in SCOP 1.71
  
• d1x8zb_ appears in SCOPe 2.04
  
• d1x8zb_ appears in SCOPe 2.06
  
• d1x8zb_ appears in the current release, SCOPe 2.08