Lineage for d1x8zb_ (1x8z B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1992366Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 1993244Superfamily a.29.6: Plant invertase/pectin methylesterase inhibitor [101148] (2 families) (S)
    contains a short alpha-hairpin at the N-terminal extension
  5. 1993245Family a.29.6.1: Plant invertase/pectin methylesterase inhibitor [101149] (3 protein domains)
    Pfam PF04043
  6. 1993253Protein Pectin methylesterase inhibitor 1, PMEI1 [116887] (1 species)
    forms dimers and trimers by swapping the extra N-terminal hairpins
  7. 1993254Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [116888] (3 PDB entries)
    Uniprot Q9LNF2 28-176
  8. 1993259Domain d1x8zb_: 1x8z B: [114971]
    Other proteins in same PDB: d1x8za2, d1x8zc2

Details for d1x8zb_

PDB Entry: 1x8z (more details), 2.86 Å

PDB Description: Crystal structure of a pectin methylesterase inhibitor from Arabidopsis thaliana
PDB Compounds: (B:) invertase/pectin methylesterase inhibitor family protein

SCOPe Domain Sequences for d1x8zb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x8zb_ a.29.6.1 (B:) Pectin methylesterase inhibitor 1, PMEI1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
semsticdktlnpsfclkflntkfaspnlqalakttldstqaratqtlkklqsiidggvd
prsklayrscvdeyesaignleeafehlasgdgmgmnmkvsaaldgadtclddvkrlrsv
dssvvnnsktiknlcgialvisnmlpr

SCOPe Domain Coordinates for d1x8zb_:

Click to download the PDB-style file with coordinates for d1x8zb_.
(The format of our PDB-style files is described here.)

Timeline for d1x8zb_: