Lineage for d1x8va_ (1x8v A:)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 646332Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 646333Superfamily a.104.1: Cytochrome P450 [48264] (1 family) (S)
  5. 646334Family a.104.1.1: Cytochrome P450 [48265] (21 proteins)
  6. 646381Protein Cytochrome p450 14 alpha-sterol demethylase (cyp51) [48276] (1 species)
  7. 646382Species Mycobacterium tuberculosis [TaxId:1773] [48277] (6 PDB entries)
  8. 646383Domain d1x8va_: 1x8v A: [114968]
    complexed with esl, hem; mutant

Details for d1x8va_

PDB Entry: 1x8v (more details), 1.55 Å

PDB Description: Estriol-bound and ligand-free structures of sterol 14alpha-demethylase (CYP51)
PDB Compounds: (A:) cytochrome p450 51

SCOP Domain Sequences for d1x8va_:

Sequence, based on SEQRES records: (download)

>d1x8va_ a.104.1.1 (A:) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis [TaxId: 1773]}
savalprvsgghdehghleefrtdpiglmqrvrdelgdvgtfqlagkqvvllsgshanef
ffragdddldqakaypfmtpifgegvvfdasperrkemlhnaalrgeqmkghaatiedqv
rrmiadwgeageidlldffaeltiytssacligkkfrdqldgrfaklyhelergtdplay
vdpylpiesfrrrdearnglvalvadimngrianpptdksdrdmldvliavkaetgtprf
sadeitgmfismmfaghhtssgtaswtlielmrhrdayaavideldelygdgrsvsfhal
rqipqlenvlketlrlhppliilmrvakgefevqghrihegdlvaaspaisnripedfpd
phdfvparyeqprqedllnrwtwipfgagrhrcvgaafaimqikaifsvllreyefemaq
ppesyrndhskmvvqlaqpaavryrrrt

Sequence, based on observed residues (ATOM records): (download)

>d1x8va_ a.104.1.1 (A:) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis [TaxId: 1773]}
savalprvsgghdehghleefrtdpiglmqrvrdelgdvgtfqlagkqvvllsgshanef
ffragdddldqakaypfmtpifgrrkemlhnaalrgeqmkghaatiedqvrrmiadwgea
geidlldffaeltiytssacligkkfrdqldgrfaklyhelergtdplayvdpylpiesf
rrrdearnglvalvadimngrianprdmldvliavkatprfsadeitgmfismmfaghht
ssgtaswtlielmrhrdayaavideldelygdgrsvsfhalrqipqlenvlketlrlhpp
liilmrvakgefevqghrihegdlvaaspaisnripedfpdphdfvparyeqprqedlln
rwtwipfgagrhrcvgaafaimqikaifsvllreyefemaqppesyrndhskmvvqlaqp
aavryrrrt

SCOP Domain Coordinates for d1x8va_:

Click to download the PDB-style file with coordinates for d1x8va_.
(The format of our PDB-style files is described here.)

Timeline for d1x8va_: