Lineage for d1x8va_ (1x8v A:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 542252Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 542253Superfamily a.104.1: Cytochrome P450 [48264] (1 family) (S)
  5. 542254Family a.104.1.1: Cytochrome P450 [48265] (21 proteins)
  6. 542289Protein Cytochrome p450 14 alpha-sterol demethylase (cyp51) [48276] (1 species)
  7. 542290Species Mycobacterium tuberculosis [TaxId:1773] [48277] (5 PDB entries)
  8. 542291Domain d1x8va_: 1x8v A: [114968]
    complexed with esl, hem; mutant

Details for d1x8va_

PDB Entry: 1x8v (more details), 1.55 Å

PDB Description: Estriol-bound and ligand-free structures of sterol 14alpha-demethylase (CYP51)

SCOP Domain Sequences for d1x8va_:

Sequence, based on SEQRES records: (download)

>d1x8va_ a.104.1.1 (A:) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis}
savalprvsgghdehghleefrtdpiglmqrvrdelgdvgtfqlagkqvvllsgshanef
ffragdddldqakaypfmtpifgegvvfdasperrkemlhnaalrgeqmkghaatiedqv
rrmiadwgeageidlldffaeltiytssacligkkfrdqldgrfaklyhelergtdplay
vdpylpiesfrrrdearnglvalvadimngrianpptdksdrdmldvliavkaetgtprf
sadeitgmfismmfaghhtssgtaswtlielmrhrdayaavideldelygdgrsvsfhal
rqipqlenvlketlrlhppliilmrvakgefevqghrihegdlvaaspaisnripedfpd
phdfvparyeqprqedllnrwtwipfgagrhrcvgaafaimqikaifsvllreyefemaq
ppesyrndhskmvvqlaqpaavryrrrt

Sequence, based on observed residues (ATOM records): (download)

>d1x8va_ a.104.1.1 (A:) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis}
savalprvsgghdehghleefrtdpiglmqrvrdelgdvgtfqlagkqvvllsgshanef
ffragdddldqakaypfmtpifgrrkemlhnaalrgeqmkghaatiedqvrrmiadwgea
geidlldffaeltiytssacligkkfrdqldgrfaklyhelergtdplayvdpylpiesf
rrrdearnglvalvadimngrianprdmldvliavkatprfsadeitgmfismmfaghht
ssgtaswtlielmrhrdayaavideldelygdgrsvsfhalrqipqlenvlketlrlhpp
liilmrvakgefevqghrihegdlvaaspaisnripedfpdphdfvparyeqprqedlln
rwtwipfgagrhrcvgaafaimqikaifsvllreyefemaqppesyrndhskmvvqlaqp
aavryrrrt

SCOP Domain Coordinates for d1x8va_:

Click to download the PDB-style file with coordinates for d1x8va_.
(The format of our PDB-style files is described here.)

Timeline for d1x8va_: