Lineage for d1x8va_ (1x8v A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2004933Family a.104.1.1: Cytochrome P450 [48265] (23 protein domains)
  6. 2005011Protein Cytochrome p450 14 alpha-sterol demethylase (cyp51) [48276] (1 species)
  7. 2005012Species Mycobacterium tuberculosis [TaxId:1773] [48277] (5 PDB entries)
    Uniprot P0A512 P77901
  8. 2005013Domain d1x8va_: 1x8v A: [114968]
    complexed with esl, hem

Details for d1x8va_

PDB Entry: 1x8v (more details), 1.55 Å

PDB Description: Estriol-bound and ligand-free structures of sterol 14alpha-demethylase (CYP51)
PDB Compounds: (A:) cytochrome p450 51

SCOPe Domain Sequences for d1x8va_:

Sequence, based on SEQRES records: (download)

>d1x8va_ a.104.1.1 (A:) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis [TaxId: 1773]}
savalprvsgghdehghleefrtdpiglmqrvrdelgdvgtfqlagkqvvllsgshanef
ffragdddldqakaypfmtpifgegvvfdasperrkemlhnaalrgeqmkghaatiedqv
rrmiadwgeageidlldffaeltiytssacligkkfrdqldgrfaklyhelergtdplay
vdpylpiesfrrrdearnglvalvadimngrianpptdksdrdmldvliavkaetgtprf
sadeitgmfismmfaghhtssgtaswtlielmrhrdayaavideldelygdgrsvsfhal
rqipqlenvlketlrlhppliilmrvakgefevqghrihegdlvaaspaisnripedfpd
phdfvparyeqprqedllnrwtwipfgagrhrcvgaafaimqikaifsvllreyefemaq
ppesyrndhskmvvqlaqpaavryrrrt

Sequence, based on observed residues (ATOM records): (download)

>d1x8va_ a.104.1.1 (A:) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis [TaxId: 1773]}
savalprvsgghdehghleefrtdpiglmqrvrdelgdvgtfqlagkqvvllsgshanef
ffragdddldqakaypfmtpifgrrkemlhnaalrgeqmkghaatiedqvrrmiadwgea
geidlldffaeltiytssacligkkfrdqldgrfaklyhelergtdplayvdpylpiesf
rrrdearnglvalvadimngrianprdmldvliavkatprfsadeitgmfismmfaghht
ssgtaswtlielmrhrdayaavideldelygdgrsvsfhalrqipqlenvlketlrlhpp
liilmrvakgefevqghrihegdlvaaspaisnripedfpdphdfvparyeqprqedlln
rwtwipfgagrhrcvgaafaimqikaifsvllreyefemaqppesyrndhskmvvqlaqp
aavryrrrt

SCOPe Domain Coordinates for d1x8va_:

Click to download the PDB-style file with coordinates for d1x8va_.
(The format of our PDB-style files is described here.)

Timeline for d1x8va_: