SCOP 1.71: Domain d1x8qa_: 1x8q A:

Lineage for d1x8qa_ (1x8q A:)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (5 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.1: Retinol binding protein-like [50815] (19 proteins)
   barrel, closed; n=8, S=12, meander

6. Protein Nitrophorin 4 [50845] (1 species)

7. Species Rhodnius prolixus [TaxId:13249] [50846] (22 PDB entries)

8. Domain d1x8qa_: 1x8q A: [114966]
   complexed with hem

Details for d1x8qa_

PDB Entry: 1x8q, 0.85 Å

PDB Description: 0.85 A Crystal Structure Of Nitrophorin 4 From Rhodnius Prolixus in Complex with Water at pH 5.6

SCOP Domain Sequences for d1x8qa_:

Sequence; same for both SEQRES and ATOM records:

>d1x8qa_ b.60.1.1 (A:) Nitrophorin 4 {Rhodnius prolixus}
actknaiaqtgfnkdkyfngdvwyvtdyldlepddvpkrycaalaagtasgklkealyhy
dpktqdtfydvselqveslgkytanfkkvdkngnvkvavtagnyytftvmyaddssalih
tclhkgnkdlgdlyavlnrnkdaaagdkvksavsaatlefskfistkenncaydndslks
lltk

Timeline for d1x8qa_:

• d1x8qa_ is new in SCOP 1.71
  
• d1x8qa_ appears in SCOP 1.73
  
• d1x8qa_ appears in the current release, SCOPe 2.08