Lineage for d1x8qa_ (1x8q A:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 564341Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 564342Superfamily b.60.1: Lipocalins [50814] (5 families) (S)
    bind hydrophobic ligands in their interior
  5. 564343Family b.60.1.1: Retinol binding protein-like [50815] (19 proteins)
    barrel, closed; n=8, S=12, meander
  6. 564463Protein Nitrophorin 4 [50845] (1 species)
  7. 564464Species Rhodnius prolixus [TaxId:13249] [50846] (22 PDB entries)
  8. 564465Domain d1x8qa_: 1x8q A: [114966]
    complexed with hem

Details for d1x8qa_

PDB Entry: 1x8q (more details), 0.85 Å

PDB Description: 0.85 A Crystal Structure Of Nitrophorin 4 From Rhodnius Prolixus in Complex with Water at pH 5.6

SCOP Domain Sequences for d1x8qa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x8qa_ b.60.1.1 (A:) Nitrophorin 4 {Rhodnius prolixus}
actknaiaqtgfnkdkyfngdvwyvtdyldlepddvpkrycaalaagtasgklkealyhy
dpktqdtfydvselqveslgkytanfkkvdkngnvkvavtagnyytftvmyaddssalih
tclhkgnkdlgdlyavlnrnkdaaagdkvksavsaatlefskfistkenncaydndslks
lltk

SCOP Domain Coordinates for d1x8qa_:

Click to download the PDB-style file with coordinates for d1x8qa_.
(The format of our PDB-style files is described here.)

Timeline for d1x8qa_: