Lineage for d1x8ha1 (1x8h A:41-307)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2231215Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 2231216Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) (S)
  5. 2231217Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 proteins)
  6. 2231218Protein Zn metallo-beta-lactamase [56283] (12 species)
  7. 2231219Species Aeromonas hydrophila, CphA [TaxId:644] [118144] (11 PDB entries)
    Uniprot P26918 28-252
  8. 2231222Domain d1x8ha1: 1x8h A:41-307 [114961]
    Other proteins in same PDB: d1x8ha2
    complexed with co3, gol, so4, zn; mutant

Details for d1x8ha1

PDB Entry: 1x8h (more details), 1.6 Å

PDB Description: the mono-zinc carbapenemase cpha (n220g mutant) shows a zn(ii)- nh2 arg coordination
PDB Compounds: (A:) Beta-lactamase

SCOPe Domain Sequences for d1x8ha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x8ha1 d.157.1.1 (A:41-307) Zn metallo-beta-lactamase {Aeromonas hydrophila, CphA [TaxId: 644]}
agmsltqvsgpvyvvednyyvqensmvyfgakgvtvvgatwtpdtarelhklikrvsrkp
vlevintnyhtdraggnaywksigakvvstrqtrdlmksdwaeivaftrkglpeypdlpl
vlpnvvhdgdftlqegkvrafyagpahtpdgifvyfpdeqvlyggcilkeklgnlsfadv
kaypqtlerlkamklpiktvigghdsplhgpelidhyealikaapqs

SCOPe Domain Coordinates for d1x8ha1:

Click to download the PDB-style file with coordinates for d1x8ha1.
(The format of our PDB-style files is described here.)

Timeline for d1x8ha1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1x8ha2