Lineage for d1x8ha_ (1x8h A:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 736616Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 736617Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (11 families) (S)
  5. 736618Family d.157.1.1: Zn metallo-beta-lactamase [56282] (1 protein)
  6. 736619Protein Zn metallo-beta-lactamase [56283] (8 species)
  7. 736620Species Aeromonas hydrophila, CphA [TaxId:644] [118144] (4 PDB entries)
  8. 736621Domain d1x8ha_: 1x8h A: [114961]
    complexed with co3, gol, sul, zn; mutant

Details for d1x8ha_

PDB Entry: 1x8h (more details), 1.6 Å

PDB Description: the mono-zinc carbapenemase cpha (n220g mutant) shows a zn(ii)- nh2 arg coordination
PDB Compounds: (A:) Beta-lactamase

SCOP Domain Sequences for d1x8ha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x8ha_ d.157.1.1 (A:) Zn metallo-beta-lactamase {Aeromonas hydrophila, CphA [TaxId: 644]}
agmsltqvsgpvyvvednyyvqensmvyfgakgvtvvgatwtpdtarelhklikrvsrkp
vlevintnyhtdraggnaywksigakvvstrqtrdlmksdwaeivaftrkglpeypdlpl
vlpnvvhdgdftlqegkvrafyagpahtpdgifvyfpdeqvlyggcilkeklgnlsfadv
kaypqtlerlkamklpiktvigghdsplhgpelidhyealikaapqss

SCOP Domain Coordinates for d1x8ha_:

Click to download the PDB-style file with coordinates for d1x8ha_.
(The format of our PDB-style files is described here.)

Timeline for d1x8ha_: