Lineage for d1x8eb_ (1x8e B:)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 809734Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 809735Superfamily b.82.1: RmlC-like cupins [51182] (24 families) (S)
  5. 809957Family b.82.1.7: Glucose-6-phosphate isomerase, GPI [89403] (1 protein)
  6. 809958Protein Glucose-6-phosphate isomerase, GPI [89404] (2 species)
    Type II phosphoglucose isomerase
  7. 809959Species Archaeon Pyrococcus furiosus [TaxId:2261] [89405] (6 PDB entries)
    Uniprot P83194
  8. 809969Domain d1x8eb_: 1x8e B: [114959]

Details for d1x8eb_

PDB Entry: 1x8e (more details), 2.8 Å

PDB Description: Crystal structure of Pyrococcus furiosus phosphoglucose isomerase free enzyme
PDB Compounds: (B:) Glucose-6-phosphate isomerase

SCOP Domain Sequences for d1x8eb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x8eb_ b.82.1.7 (B:) Glucose-6-phosphate isomerase, GPI {Archaeon Pyrococcus furiosus [TaxId: 2261]}
mmykepfgvkvdfetgiiegakksvrrlsdmegyfvderawkelvekedpvvyevyaveq
eekegdlnfattvlypgkvgkeffftkghfhakldraevyvalkgkggmllqtpegdakw
ismepgtvvyvppywahrtvnigdepfiflaiypadaghdygtiaekgfskivieengev
kvvdnprwk

SCOP Domain Coordinates for d1x8eb_:

Click to download the PDB-style file with coordinates for d1x8eb_.
(The format of our PDB-style files is described here.)

Timeline for d1x8eb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1x8ea_