Lineage for d1x87a_ (1x87 A:)

  1. Root: SCOPe 2.07
  2. 2618030Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2626033Fold e.51: Urocanase [111325] (1 superfamily)
    3 domains; d1: alpha+beta [alpha(2)-beta(3); mixed sheet: 213]; d2: alpha/beta of the NAD(P)-binding Rossmann-fold superfamily (51735); d3: alpha+beta of the glutamine synthetase/guanido kinase fold (55930); d1 and d3 form a single beta-sheet
  4. 2626034Superfamily e.51.1: Urocanase [111326] (2 families) (S)
    automatically mapped to Pfam PF01175
  5. 2626035Family e.51.1.1: Urocanase [111327] (2 proteins)
    Pfam PF01175
  6. 2626036Protein Urocanate hydratase HutU [111328] (2 species)
  7. 2626037Species Bacillus stearothermophilus [TaxId:1422] [118200] (1 PDB entry)
    Uniprot Q5L084 # 99% sequence identity; Geobacillus kaustophilus TaxID:1462
  8. 2626038Domain d1x87a_: 1x87 A: [114956]
    Structural genomics target
    complexed with nad

Details for d1x87a_

PDB Entry: 1x87 (more details), 2.4 Å

PDB Description: 2.4A X-ray structure of Urocanase protein complexed with NAD
PDB Compounds: (A:) Urocanase protein

SCOPe Domain Sequences for d1x87a_:

Sequence, based on SEQRES records: (download)

>d1x87a_ e.51.1.1 (A:) Urocanate hydratase HutU {Bacillus stearothermophilus [TaxId: 1422]}
vrpfagterrakgwiqeaalrmlnnnlhpdvaerpdelivyggigkaarnwecyeaivdt
llrlendetlliqsgkpvavfrthpdaprvliansnlvpawatwdhfheldkkglimygq
mtagswiyigsqgivqgtyetfaevarqhfggtlagtitltaglggmggaqplavtmngg
vclaievdpariqrridtnyldtmtdsldaalemakqakeekkalsiglvgnaaevlprl
vetgfvpdvltdqtsahdplngyipagltldeaaelrardpkqyiarakqsiaahvraml
amqkqgavtfdygnnirqvakdegvddafsfpgfvpayirplfcegkgpfrwvalsgdpe
diyktdevilrefsdnerlchwirmaqkrikfqglparicwlgygerakfgkiindmvak
gelkapivigrdhldsgsvaspnretegmkdgsdaiadwpilnallnavggaswvsvhhg
ggvgmgysihagmvivadgtkeaekrlervlttdpglgvirhadagyelairtakekgid
mpmlk

Sequence, based on observed residues (ATOM records): (download)

>d1x87a_ e.51.1.1 (A:) Urocanate hydratase HutU {Bacillus stearothermophilus [TaxId: 1422]}
vrpfagterrakgwiqeaalrmlnnnlhpdvkaarnwecyeaivdtllrlendetlliqs
gkpvavfrthpdaprvliansnlvpawatwdhgswiyigsqgivqgtyetfaevarqhfg
gtlagtitltaglggmggaqplavtmnggvclaievdpariqrridtnyldtmtdsldaa
lemakqakeekkalsiglvgnaaevlprlvetgfvpdvltdqtsahdplngyipagltld
eaaelrardpkqyiarakqsiaahvramlamqkqgavtfdygnnirqvakdegvddafsf
pgfvpayirplfcegkgpfrwvalsgdpediyktdevilrefsdnerlchwirmaqkrik
fqglparicwlgygerakfgkiindmvakgelkapivigrdhldaiadwpilnallnavg
gaswvsvhhgggvgmgysihagmvivadgtkeaekrlervlttdpglgvirhadagyela
irtakekgidmpmlk

SCOPe Domain Coordinates for d1x87a_:

Click to download the PDB-style file with coordinates for d1x87a_.
(The format of our PDB-style files is described here.)

Timeline for d1x87a_: