Lineage for d1x80b1 (1x80 B:14-204)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2864564Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465
  4. 2864565Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) (S)
    there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
    two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules
  5. 2864755Family c.36.1.7: Branched-chain alpha-keto acid dehydrogenase Pyr module [88741] (5 proteins)
    parent family to TK and PFOR
    heterodimeric protein related to TK; alpha-subunit is the PP module and the N-terminal domain of beta-subunit is the Pyr module
    automatically mapped to Pfam PF02779
  6. 2864759Protein Branched-chain alpha-keto acid dehydrogenase, Pyr module [88742] (2 species)
  7. 2864760Species Human (Homo sapiens) [TaxId:9606] [88743] (23 PDB entries)
    Uniprot P21953 52-392
  8. 2864766Domain d1x80b1: 1x80 B:14-204 [114951]
    Other proteins in same PDB: d1x80a_, d1x80b2
    complexed with cl, gol, k, mn, tdp

Details for d1x80b1

PDB Entry: 1x80 (more details), 2 Å

PDB Description: crystal structure of the human mitochondrial branched-chain alpha- ketoacid dehydrogenase
PDB Compounds: (B:) 2-oxoisovalerate dehydrogenase beta subunit

SCOPe Domain Sequences for d1x80b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x80b1 c.36.1.7 (B:14-204) Branched-chain alpha-keto acid dehydrogenase, Pyr module {Human (Homo sapiens) [TaxId: 9606]}
eygqtqkmnlfqsvtsaldnslakdptavifgedvafggvfrctvglrdkygkdrvfntp
lceqgivgfgigiavtgataiaeiqfadyifpafdqivneaakyryrsgdlfncgsltir
spwgcvghgalyhsqspeaffahcpgikvviprspfqakglllsciedknpciffepkil
yraaaeevpie

SCOPe Domain Coordinates for d1x80b1:

Click to download the PDB-style file with coordinates for d1x80b1.
(The format of our PDB-style files is described here.)

Timeline for d1x80b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1x80b2
View in 3D
Domains from other chains:
(mouse over for more information)
d1x80a_