![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465 |
![]() | Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) ![]() there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules |
![]() | Family c.36.1.11: Branched-chain alpha-keto acid dehydrogenase PP module [88766] (5 proteins) parent family to TK and PFOR heterodimeric protein related to TK; alpha-subunit is the PP module and the N-terminal domain of beta-subunit is the Pyr module |
![]() | Protein Branched-chain alpha-keto acid dehydrogenase, PP module [88767] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [88768] (19 PDB entries) Uniprot P12694 52-445 |
![]() | Domain d1x7ya_: 1x7y A: [114944] Other proteins in same PDB: d1x7yb1, d1x7yb2 complexed with cl, gol, k, mn, tdp |
PDB Entry: 1x7y (more details), 1.57 Å
SCOPe Domain Sequences for d1x7ya_:
Sequence, based on SEQRES records: (download)
>d1x7ya_ c.36.1.11 (A:) Branched-chain alpha-keto acid dehydrogenase, PP module {Human (Homo sapiens) [TaxId: 9606]} pqfpgasaefidklefiqpnvisgipiyrvmdrqgqiinpsedphlpkekvlklyksmtl lntmdrilyesqrqgrisfymtnygeegthvgsaaaldntdlvfgqyreagvlmyrdypl elfmaqcygnisdlgkgrqmpvhygckerhfvtissplatqipqavgaayaakrananrv vicyfgegaasegdahagfnfaatlecpiiffcrnngyaistptseqyrgdgiaargpgy gimsirvdgndvfavynatkearrravaenqpflieamtyrighhntsddssayrsvdev nywdkqdhpisrlrhyllsqgwwdeeqekawrkqsrrkvmeafeqaerkpkpnpnllfsd vyqempaqlrkqqeslarhlqtygehypldhfdk
>d1x7ya_ c.36.1.11 (A:) Branched-chain alpha-keto acid dehydrogenase, PP module {Human (Homo sapiens) [TaxId: 9606]} pqfpgasaefidklefiqpnvisgipiyrvmdrqgqiinpsedphlpkekvlklyksmtl lntmdrilyesqrqgrisfymtnygeegthvgsaaaldntdlvfgqyreagvlmyrdypl elfmaqcygnisdlgkgrqmpvhygckerhfvtissplatqipqavgaayaakrananrv vicyfgegaasegdahagfnfaatlecpiiffcrnngyaistptseqyrgdgiaargpgy gimsirvdgndvfavynatkearrravaenqpflieamtyrdhpisrlrhyllsqgwwde eqekawrkqsrrkvmeafeqaerkpkpnpnllfsdvyqempaqlrkqqeslarhlqtyge hypldhfdk
Timeline for d1x7ya_: