| Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
| Fold c.48: TK C-terminal domain-like [52921] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 13245, strand 1 is antiparallel to the rest |
Superfamily c.48.1: TK C-terminal domain-like [52922] (3 families) ![]() |
| Family c.48.1.2: Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain [52926] (4 proteins) |
| Protein Branched-chain alpha-keto acid dehydrogenase [52927] (2 species) |
| Species Human (Homo sapiens) [TaxId:9606] [52928] (21 PDB entries) Uniprot P21953 52-392 |
| Domain d1x7xb2: 1x7x B:205-342 [114943] Other proteins in same PDB: d1x7xa_, d1x7xb1 complexed with cl, gol, k, mn, tdp |
PDB Entry: 1x7x (more details), 2.1 Å
SCOPe Domain Sequences for d1x7xb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1x7xb2 c.48.1.2 (B:205-342) Branched-chain alpha-keto acid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]}
pyniplsqaeviqegsdvtlvawgtqvhvirevasmakeklgvscevidlrtiipwdvdt
icksviktgrllisheapltggfaseisstvqeecflnleapisrvcgydtpfphifepf
yipdkwkcydalrkminy
Timeline for d1x7xb2: