SCOP 1.71: Domain d1x7xb2: 1x7x B:205-342

Lineage for d1x7xb2 (1x7x B:205-342)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.48: TK C-terminal domain-like [52921] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 13245, strand 1 is antiparallel to the rest

4. Superfamily c.48.1: TK C-terminal domain-like [52922] (3 families)

5. Family c.48.1.2: Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain [52926] (4 proteins)

6. Protein Branched-chain alpha-keto acid dehydrogenase [52927] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52928] (14 PDB entries)

8. Domain d1x7xb2: 1x7x B:205-342 [114943]
   Other proteins in same PDB: d1x7xa_, d1x7xb1
   complexed with cl, gol, k, mn, tdp; mutant

Details for d1x7xb2

PDB Entry: 1x7x, 2.1 Å

PDB Description: crystal structure of the human mitochondrial branched-chain alpha- ketoacid dehydrogenase

SCOP Domain Sequences for d1x7xb2:

Sequence; same for both SEQRES and ATOM records:

>d1x7xb2 c.48.1.2 (B:205-342) Branched-chain alpha-keto acid dehydrogenase {Human (Homo sapiens)}
pyniplsqaeviqegsdvtlvawgtqvhvirevasmakeklgvscevidlrtiipwdvdt
icksviktgrllisheapltggfaseisstvqeecflnleapisrvcgydtpfphifepf
yipdkwkcydalrkminy

Timeline for d1x7xb2:

• d1x7xb2 is new in SCOP 1.71
  
• d1x7xb2 appears in SCOP 1.73
  
• d1x7xb2 appears in the current release, SCOPe 2.08