Lineage for d1x7xa_ (1x7x A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2108258Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465
  4. 2108259Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) (S)
    there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
    two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules
  5. 2108723Family c.36.1.11: Branched-chain alpha-keto acid dehydrogenase PP module [88766] (5 protein domains)
    parent family to TK and PFOR
    heterodimeric protein related to TK; alpha-subunit is the PP module and the N-terminal domain of beta-subunit is the Pyr module
  6. 2108727Protein Branched-chain alpha-keto acid dehydrogenase, PP module [88767] (2 species)
  7. 2108728Species Human (Homo sapiens) [TaxId:9606] [88768] (19 PDB entries)
    Uniprot P12694 52-445
  8. 2108745Domain d1x7xa_: 1x7x A: [114941]
    Other proteins in same PDB: d1x7xb1, d1x7xb2
    complexed with cl, gol, k, mn, tdp

Details for d1x7xa_

PDB Entry: 1x7x (more details), 2.1 Å

PDB Description: Crystal structure of the human mitochondrial branched-chain alpha-ketoacid dehydrogenase
PDB Compounds: (A:) 2-oxoisovalerate dehydrogenase alpha subunit

SCOPe Domain Sequences for d1x7xa_:

Sequence, based on SEQRES records: (download)

>d1x7xa_ c.36.1.11 (A:) Branched-chain alpha-keto acid dehydrogenase, PP module {Human (Homo sapiens) [TaxId: 9606]}
kpqfpgasaefidklefiqpnvisgipiyrvmdrqgqiinpsedphlpkekvlklyksmt
llntmdrilyesqrqgrisfymtnygeegthvgsaaaldntdlvfgqyreagvlmyrdyp
lelfmaqcygnisdlgkgrqmpvhygckerhfvtissplatqipqavgaayaakrananr
vvicyfgegaasegdahagfnfaatlecpiiffcrnngyaistptseqyrgdgiaargpg
ygimsirvdgndvfavynatkearrravaenqpflieamtyrighhetsddssayrsvde
vnywdkqdhpisrlrhyllsqgwwdeeqekawrkqsrrkvmeafeqaerkpkpnpnllfs
dvyqempaqlrkqqeslarhlqtygehypldhfdk

Sequence, based on observed residues (ATOM records): (download)

>d1x7xa_ c.36.1.11 (A:) Branched-chain alpha-keto acid dehydrogenase, PP module {Human (Homo sapiens) [TaxId: 9606]}
kpqfpgasaefidklefiqpnvisgipiyrvmdrqgqiinpsedphlpkekvlklyksmt
llntmdrilyesqrqgrisfymtnygeegthvgsaaaldntdlvfgqyreagvlmyrdyp
lelfmaqcygnisdlgkgrqmpvhygckerhfvtissplatqipqavgaayaakrananr
vvicyfgegaasegdahagfnfaatlecpiiffcrnngyaistptseqyrgdgiaargpg
ygimsirvdgndvfavynatkearrravaenqpflieamtyrdhpisrlrhyllsqgwwd
eeqekawrkqsrrkvmeafeqaerkpkpnpnllfsdvyqempaqlrkqqeslarhlqtyg
ehypldhfdk

SCOPe Domain Coordinates for d1x7xa_:

Click to download the PDB-style file with coordinates for d1x7xa_.
(The format of our PDB-style files is described here.)

Timeline for d1x7xa_: