Lineage for d1x7ua2 (1x7u A:441-748)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 541091Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 541092Superfamily a.93.1: Heme-dependent peroxidases [48113] (3 families) (S)
  5. 541370Family a.93.1.3: Catalase-peroxidase KatG [74753] (1 protein)
    duplication: tandem repeat of two CCP-like domains
  6. 541371Protein Catalase-peroxidase KatG [74754] (4 species)
    only the N-terminal CCP-like domain binds heme
  7. 541377Species Burkholderia pseudomallei [TaxId:28450] [89093] (5 PDB entries)
  8. 541383Domain d1x7ua2: 1x7u A:441-748 [114935]

Details for d1x7ua2

PDB Entry: 1x7u (more details), 1.9 Å

PDB Description: crystal structure of the s324t of catalase-peroxidase katg

SCOP Domain Sequences for d1x7ua2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x7ua2 a.93.1.3 (A:441-748) Catalase-peroxidase KatG {Burkholderia pseudomallei}
aevllwqdpipavdhplidaadaaelkakvlasgltvsqlvstawaaastfrgsdkrgga
ngarirlapqkdweanqpeqlaavletleairtafngaqrggkqvsladlivlagcagve
qaaknaghavtvpfapgradasqeqtdvesmavlepvadgfrnylkgkyrvpaevllvdk
aqlltlsapemtvllgglrvlganvgqsrhgvftareqaltndffvnlldmgtewkptaa
dadvfegrdratgelkwtgtrvdlvfgshsqlralaevygsadaqekfvrdfvavwnkvm
nldrfdla

SCOP Domain Coordinates for d1x7ua2:

Click to download the PDB-style file with coordinates for d1x7ua2.
(The format of our PDB-style files is described here.)

Timeline for d1x7ua2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1x7ua1