SCOPe 2.07: Domain d1x7na1: 1x7n A:1-188

Lineage for d1x7na1 (1x7n A:1-188)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.1: RmlC-like cupins [51182] (25 families)

5. Family b.82.1.7: Glucose-6-phosphate isomerase, GPI [89403] (2 proteins)
   automatically mapped to Pfam PF06560

6. Protein Glucose-6-phosphate isomerase, GPI [89404] (2 species)
   Type II phosphoglucose isomerase

7. Species Pyrococcus furiosus [TaxId:2261] [89405] (10 PDB entries)
   Uniprot P83194

8. Domain d1x7na1: 1x7n A:1-188 [114933]
   Other proteins in same PDB: d1x7na2
   complexed with mn, pa5

Details for d1x7na1

PDB Entry: 1x7n, 1.89 Å

PDB Description: the crystal structure of pyrococcus furiosus phosphoglucose isomerase with bound 5-phospho-d-arabinonate and manganese

PDB Compounds: (A:) Glucose-6-phosphate isomerase

SCOPe Domain Sequences for d1x7na1:

Sequence; same for both SEQRES and ATOM records:

>d1x7na1 b.82.1.7 (A:1-188) Glucose-6-phosphate isomerase, GPI {Pyrococcus furiosus [TaxId: 2261]}
mykepfgvkvdfetgiiegakksvrrlsdmegyfvderawkelvekedpvvyevyaveqe
ekegdlnfattvlypgkvgkeffftkghfhakldraevyvalkgkggmllqtpegdakwi
smepgtvvyvppywahrtvnigdepfiflaiypadaghdygtiaekgfskivieengevk
vvdnprwk

Timeline for d1x7na1:

• d1x7na1 first appeared in SCOP 1.71, called d1x7na_
  
• d1x7na1 appears in SCOPe 2.06
  
• d1x7na1 appears in the current release, SCOPe 2.08