SCOP 1.71: Domain d1x7na_: 1x7n A:

Lineage for d1x7na_ (1x7n A:)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.1: RmlC-like cupins [51182] (16 families)

5. Family b.82.1.7: Glucose-6-phosphate isomerase, GPI [89403] (1 protein)

6. Protein Glucose-6-phosphate isomerase, GPI [89404] (2 species)
   Type II phosphoglucose isomerase

7. Species Archaeon Pyrococcus furiosus [TaxId:2261] [89405] (6 PDB entries)

8. Domain d1x7na_: 1x7n A: [114933]
   complexed with mn, pa5

Details for d1x7na_

PDB Entry: 1x7n, 1.89 Å

PDB Description: the crystal structure of pyrococcus furiosus phosphoglucose isomerase with bound 5-phospho-d-arabinonate and manganese

SCOP Domain Sequences for d1x7na_:

Sequence; same for both SEQRES and ATOM records:

>d1x7na_ b.82.1.7 (A:) Glucose-6-phosphate isomerase, GPI {Archaeon Pyrococcus furiosus}
mmykepfgvkvdfetgiiegakksvrrlsdmegyfvderawkelvekedpvvyevyaveq
eekegdlnfattvlypgkvgkeffftkghfhakldraevyvalkgkggmllqtpegdakw
ismepgtvvyvppywahrtvnigdepfiflaiypadaghdygtiaekgfskivieengev
kvvdnprwk

Timeline for d1x7na_:

• d1x7na_ is new in SCOP 1.71
  
• d1x7na_ appears in SCOP 1.73
  
• d1x7na_ appears in the current release, SCOPe 2.08, called d1x7na1