Lineage for d1x7da_ (1x7d A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845780Family c.2.1.13: Ornithine cyclodeaminase-like [110436] (2 proteins)
    Pfam PF02423; contains additional alpha+beta dimerisation subdomain mostly formed by the N-terminal meander beta-sheet
  6. 2845787Protein Ornithine cyclodeaminase [117437] (1 species)
  7. 2845788Species Pseudomonas putida [TaxId:303] [117438] (2 PDB entries)
    Uniprot Q88H32
  8. 2845789Domain d1x7da_: 1x7d A: [114927]
    complexed with mes, mpd, na, nad, orn

Details for d1x7da_

PDB Entry: 1x7d (more details), 1.6 Å

PDB Description: Crystal Structure Analysis of Ornithine Cyclodeaminase Complexed with NAD and ornithine to 1.6 Angstroms
PDB Compounds: (A:) ornithine cyclodeaminase

SCOPe Domain Sequences for d1x7da_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x7da_ c.2.1.13 (A:) Ornithine cyclodeaminase {Pseudomonas putida [TaxId: 303]}
tyfidvptmsdlvhdigvapfigelaaalrddfkrwqafdksarvashsevgvielmpva
dksryafkyvnghpantarnlhtvmafgvladvdsgypvllseltiatalrtaatslmaa
qalarpnarkmaligngaqsefqalafhkhlgieeivaydtdplataklianlkeysglt
irrassvaeavkgvdiittvtadkayatiitpdmlepgmhlnavggdcpgktelhadvlr
narvfveyepqtriegeiqqlpadfpvvdlwrvlrgetegrqsdsqvtvfdsvgfaledy
tvlryvlqqaekrgmgtkidlvpwveddpkdlfshtrgra

SCOPe Domain Coordinates for d1x7da_:

Click to download the PDB-style file with coordinates for d1x7da_.
(The format of our PDB-style files is described here.)

Timeline for d1x7da_: