SCOPe 2.07: Domain d1x79c_: 1x79 C:

Lineage for d1x79c_ (1x79 C:)

1. Root: SCOPe 2.07

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
   this is not a true fold; includes oligomers of shorter identical helices

4. Superfamily h.1.27: G protein-binding domain [103652] (2 families)

5. Family h.1.27.2: Rabaptin-5 [118367] (2 proteins)

6. Protein Rabaptin-5 [118368] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [118369] (2 PDB entries)
   Uniprot Q15276 552-641, 804-849

8. Domain d1x79c_: 1x79 C: [114926]
   Other proteins in same PDB: d1x79a_
   complexed with dtt, so4

Details for d1x79c_

PDB Entry: 1x79, 2.41 Å

PDB Description: crystal structure of human gga1 gat domain complexed with the gat- binding domain of rabaptin5

PDB Compounds: (C:) Rab GTPase binding effector protein 1

SCOPe Domain Sequences for d1x79c_:

Sequence; same for both SEQRES and ATOM records:

>d1x79c_ h.1.27.2 (C:) Rabaptin-5 {Human (Homo sapiens) [TaxId: 9606]}
trdqvkklqlmlrqandqlektmkdkqeledfikqssedsshqisalvlraqaseillee
lqqglsqakrdvqeqmavlmqsreqvse

Timeline for d1x79c_:

• d1x79c_ first appeared in SCOP 1.71
  
• d1x79c_ appears in SCOPe 2.06
  
• d1x79c_ appears in the current release, SCOPe 2.08