| Class h: Coiled coil proteins [57942] (7 folds) |
| Fold h.1: Parallel coiled-coil [57943] (29 superfamilies) this is not a true fold; includes oligomers of shorter identical helices |
Superfamily h.1.27: G protein-binding domain [103652] (2 families) ![]() |
| Family h.1.27.2: Rabaptin-5 [118367] (1 protein) |
| Protein Rabaptin-5 [118368] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [118369] (2 PDB entries) |
| Domain d1x79c_: 1x79 C: [114926] Other proteins in same PDB: d1x79a_ complexed with dtt, so4 |
PDB Entry: 1x79 (more details), 2.41 Å
SCOP Domain Sequences for d1x79c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1x79c_ h.1.27.2 (C:) Rabaptin-5 {Human (Homo sapiens)}
trdqvkklqlmlrqandqlektmkdkqeledfikqssedsshqisalvlraqaseillee
lqqglsqakrdvqeqmavlmqsreqvse
Timeline for d1x79c_: