![]() | Class h: Coiled coil proteins [57942] (7 folds) |
![]() | Fold h.1: Parallel coiled-coil [57943] (29 superfamilies) this is not a true fold; includes oligomers of shorter identical helices |
![]() | Superfamily h.1.27: G protein-binding domain [103652] (2 families) ![]() |
![]() | Family h.1.27.2: Rabaptin-5 [118367] (1 protein) |
![]() | Protein Rabaptin-5 [118368] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [118369] (2 PDB entries) |
![]() | Domain d1x79b_: 1x79 B: [114925] Other proteins in same PDB: d1x79a_ |
PDB Entry: 1x79 (more details), 2.41 Å
SCOP Domain Sequences for d1x79b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1x79b_ h.1.27.2 (B:) Rabaptin-5 {Human (Homo sapiens)} etrdqvkklqlmlrqandqlektmkdkqeledfikqssedsshqisalvlraqaseille elqqglsqakrdvqeqmavlmqsreqvsee
Timeline for d1x79b_: