Lineage for d1x79b_ (1x79 B:)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3039231Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 3040566Superfamily h.1.27: G protein-binding domain [103652] (2 families) (S)
  5. 3040575Family h.1.27.2: Rabaptin-5 [118367] (2 proteins)
  6. 3040576Protein Rabaptin-5 [118368] (1 species)
  7. 3040577Species Human (Homo sapiens) [TaxId:9606] [118369] (2 PDB entries)
    Uniprot Q15276 552-641, 804-849
  8. 3040583Domain d1x79b_: 1x79 B: [114925]
    Other proteins in same PDB: d1x79a_
    complexed with dtt, so4

Details for d1x79b_

PDB Entry: 1x79 (more details), 2.41 Å

PDB Description: crystal structure of human gga1 gat domain complexed with the gat- binding domain of rabaptin5
PDB Compounds: (B:) Rab GTPase binding effector protein 1

SCOPe Domain Sequences for d1x79b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x79b_ h.1.27.2 (B:) Rabaptin-5 {Human (Homo sapiens) [TaxId: 9606]}
etrdqvkklqlmlrqandqlektmkdkqeledfikqssedsshqisalvlraqaseille
elqqglsqakrdvqeqmavlmqsreqvsee

SCOPe Domain Coordinates for d1x79b_:

Click to download the PDB-style file with coordinates for d1x79b_.
(The format of our PDB-style files is described here.)

Timeline for d1x79b_: