Lineage for d1x79a_ (1x79 A:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 534473Fold a.7: Spectrin repeat-like [46965] (13 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down
  4. 534615Superfamily a.7.8: GAT-like domain [89009] (2 families) (S)
  5. 534616Family a.7.8.1: GAT domain [89010] (1 protein)
    this is a repeat family; one repeat unit is 1yd8 G:208-299 found in domain
  6. 534617Protein ADP-ribosylation factor binding protein Gga1 [89011] (1 species)
  7. 534618Species Human (Homo sapiens) [TaxId:9606] [89012] (6 PDB entries)
  8. 534624Domain d1x79a_: 1x79 A: [114924]
    Other proteins in same PDB: d1x79b_, d1x79c_
    complexed with dtt, so4

Details for d1x79a_

PDB Entry: 1x79 (more details), 2.41 Å

PDB Description: crystal structure of human gga1 gat domain complexed with the gat- binding domain of rabaptin5

SCOP Domain Sequences for d1x79a_:

Sequence, based on SEQRES records: (download)

>d1x79a_ a.7.8.1 (A:) ADP-ribosylation factor binding protein Gga1 {Human (Homo sapiens)}
iskrvnaieevnnnvklltemvmshsqggaaagssedlmkelyqrcermrptlfrlasdt
edndealaeilqandnltqvinlykqlvr

Sequence, based on observed residues (ATOM records): (download)

>d1x79a_ a.7.8.1 (A:) ADP-ribosylation factor binding protein Gga1 {Human (Homo sapiens)}
iskrvnaieevnnnvklltemvmshsssedlmkelyqrcermrptlfrlasdtedndeal
aeilqandnltqvinlykqlvr

SCOP Domain Coordinates for d1x79a_:

Click to download the PDB-style file with coordinates for d1x79a_.
(The format of our PDB-style files is described here.)

Timeline for d1x79a_: