Lineage for d1x79a_ (1x79 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2696503Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down
  4. 2696791Superfamily a.7.8: GAT-like domain [89009] (3 families) (S)
  5. 2696792Family a.7.8.1: GAT domain [89010] (4 proteins)
    this is a repeat family; one repeat unit is 1yd8 G:208-299 found in domain
  6. 2696793Protein ADP-ribosylation factor binding protein Gga1 [89011] (1 species)
  7. 2696794Species Human (Homo sapiens) [TaxId:9606] [89012] (7 PDB entries)
    Uniprot Q9UJY5 211-299
  8. 2696799Domain d1x79a_: 1x79 A: [114924]
    Other proteins in same PDB: d1x79b_, d1x79c_
    complexed with dtt, so4

Details for d1x79a_

PDB Entry: 1x79 (more details), 2.41 Å

PDB Description: crystal structure of human gga1 gat domain complexed with the gat- binding domain of rabaptin5
PDB Compounds: (A:) ADP-ribosylation factor binding protein GGA1

SCOPe Domain Sequences for d1x79a_:

Sequence, based on SEQRES records: (download)

>d1x79a_ a.7.8.1 (A:) ADP-ribosylation factor binding protein Gga1 {Human (Homo sapiens) [TaxId: 9606]}
iskrvnaieevnnnvklltemvmshsqggaaagssedlmkelyqrcermrptlfrlasdt
edndealaeilqandnltqvinlykqlvr

Sequence, based on observed residues (ATOM records): (download)

>d1x79a_ a.7.8.1 (A:) ADP-ribosylation factor binding protein Gga1 {Human (Homo sapiens) [TaxId: 9606]}
iskrvnaieevnnnvklltemvmshsssedlmkelyqrcermrptlfrlasdtedndeal
aeilqandnltqvinlykqlvr

SCOPe Domain Coordinates for d1x79a_:

Click to download the PDB-style file with coordinates for d1x79a_.
(The format of our PDB-style files is described here.)

Timeline for d1x79a_: