Lineage for d1x6mb_ (1x6m B:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1810140Fold b.88: Mss4-like [51315] (2 superfamilies)
    complex fold made of several coiled beta-sheets
  4. 1810141Superfamily b.88.1: Mss4-like [51316] (5 families) (S)
    duplication: tandem repeat of two similar structural motifs
  5. 1810194Family b.88.1.4: Glutathione-dependent formaldehyde-activating enzyme, Gfa [117338] (1 protein)
    Pfam PF04828; DUF636
  6. 1810195Protein Glutathione-dependent formaldehyde-activating enzyme, Gfa [117339] (1 species)
  7. 1810196Species Paracoccus denitrificans [TaxId:266] [117340] (2 PDB entries)
    Uniprot Q51669
  8. 1810198Domain d1x6mb_: 1x6m B: [114921]
    complexed with gol, so4, zn

Details for d1x6mb_

PDB Entry: 1x6m (more details), 2.35 Å

PDB Description: crystal structure of the glutathione-dependent formaldehyde-activating enzyme (gfa)
PDB Compounds: (B:) Glutathione-dependent formaldehyde-activating enzyme

SCOPe Domain Sequences for d1x6mb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x6mb_ b.88.1.4 (B:) Glutathione-dependent formaldehyde-activating enzyme, Gfa {Paracoccus denitrificans [TaxId: 266]}
ghmvdtsgvkihpavdngikpaqpgfaggtlhckcstnpvrvavraqtahnhvcgctkcw
kpegaifsqvavvgrdalevlegaekleivnaeapiqrhrcrdcgvhmygrienrdhpfy
gldfvhtelsdedgwsapefaafvssiiesgvdpsrmeairarlrelglepydalspplm
daiathiakrsgalaa

SCOPe Domain Coordinates for d1x6mb_:

Click to download the PDB-style file with coordinates for d1x6mb_.
(The format of our PDB-style files is described here.)

Timeline for d1x6mb_: