Class b: All beta proteins [48724] (176 folds) |
Fold b.88: Mss4-like [51315] (2 superfamilies) complex fold made of several coiled beta-sheets |
Superfamily b.88.1: Mss4-like [51316] (5 families) duplication: tandem repeat of two similar structural motifs |
Family b.88.1.4: Glutathione-dependent formaldehyde-activating enzyme, Gfa [117338] (1 protein) Pfam PF04828; DUF636 |
Protein Glutathione-dependent formaldehyde-activating enzyme, Gfa [117339] (1 species) |
Species Paracoccus denitrificans [TaxId:266] [117340] (2 PDB entries) Uniprot Q51669 |
Domain d1x6mb_: 1x6m B: [114921] complexed with gol, so4, zn |
PDB Entry: 1x6m (more details), 2.35 Å
SCOPe Domain Sequences for d1x6mb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1x6mb_ b.88.1.4 (B:) Glutathione-dependent formaldehyde-activating enzyme, Gfa {Paracoccus denitrificans [TaxId: 266]} ghmvdtsgvkihpavdngikpaqpgfaggtlhckcstnpvrvavraqtahnhvcgctkcw kpegaifsqvavvgrdalevlegaekleivnaeapiqrhrcrdcgvhmygrienrdhpfy gldfvhtelsdedgwsapefaafvssiiesgvdpsrmeairarlrelglepydalspplm daiathiakrsgalaa
Timeline for d1x6mb_: