SCOPe 2.06: Domain d1x6ma1: 1x6m A:4-196

Lineage for d1x6ma1 (1x6m A:4-196)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.88: Mss4-like [51315] (2 superfamilies)
   complex fold made of several coiled beta-sheets

4. Superfamily b.88.1: Mss4-like [51316] (5 families)
   duplication: tandem repeat of two similar structural motifs

5. Family b.88.1.4: Glutathione-dependent formaldehyde-activating enzyme, Gfa [117338] (1 protein)
   Pfam PF04828; DUF636

6. Protein Glutathione-dependent formaldehyde-activating enzyme, Gfa [117339] (1 species)

7. Species Paracoccus denitrificans [TaxId:266] [117340] (2 PDB entries)
   Uniprot Q51669

8. Domain d1x6ma1: 1x6m A:4-196 [114920]
   Other proteins in same PDB: d1x6ma2, d1x6mb2, d1x6mc2, d1x6md2
   complexed with gol, so4, zn

Details for d1x6ma1

PDB Entry: 1x6m, 2.35 Å

PDB Description: crystal structure of the glutathione-dependent formaldehyde-activating enzyme (gfa)

PDB Compounds: (A:) Glutathione-dependent formaldehyde-activating enzyme

SCOPe Domain Sequences for d1x6ma1:

Sequence; same for both SEQRES and ATOM records:

>d1x6ma1 b.88.1.4 (A:4-196) Glutathione-dependent formaldehyde-activating enzyme, Gfa {Paracoccus denitrificans [TaxId: 266]}
vdtsgvkihpavdngikpaqpgfaggtlhckcstnpvrvavraqtahnhvcgctkcwkpe
gaifsqvavvgrdalevlegaekleivnaeapiqrhrcrdcgvhmygrienrdhpfygld
fvhtelsdedgwsapefaafvssiiesgvdpsrmeairarlrelglepydalspplmdai
athiakrsgalaa

Timeline for d1x6ma1:

• d1x6ma1 first appeared in SCOP 1.71, called d1x6ma_
  
• d1x6ma1 was called d1x6ma_ in SCOPe 2.05
  
• d1x6ma1 appears in SCOPe 2.07
  
• d1x6ma1 appears in the current release, SCOPe 2.08