SCOP 1.71: Domain d1wvid_: 1wvi D:

Lineage for d1wvid_ (1wvi D:)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.108: HAD-like [56783] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.108.1: HAD-like [56784] (18 families)
   usually contains an insertion (sub)domain after strand 1

5. Family c.108.1.14: NagD-like [102317] (2 proteins)
   duplication: consists of two segment-swapped domains of this fold; this results in the insertion of a circularly permuted domain after strand 3, analogously to the Cof family

6. Protein Putative phosphatase SMU.1415c [117507] (1 species)

7. Species Streptococcus mutans [TaxId:1309] [117508] (1 PDB entry)

8. Domain d1wvid_: 1wvi D: [114918]
   Structural genomics target

Details for d1wvid_

PDB Entry: 1wvi, 2.3 Å

PDB Description: crystal structure of putative phosphatase from streptococcus mutans ua159

SCOP Domain Sequences for d1wvid_:

Sequence; same for both SEQRES and ATOM records:

>d1wvid_ c.108.1.14 (D:) Putative phosphatase SMU.1415c {Streptococcus mutans}
tykgylidldgtiykgkdripagedfvkrlqerqlpyilvtnnttrtpemvqemlatsfn
iktpletiytatlatidymndmkrgktayvigetglkkavaeagyredsenpayvvvgld
tnltyekltlatlaiqkgavfigtnpdlniptergllpgagailfllekatrvkpiiigk
peavimnkaldrlgvkrheaimvgdnyltditagikndiatllvttgftkpeevpalpiq
pdfvlsslaewdf

Timeline for d1wvid_:

• d1wvid_ is new in SCOP 1.71
  
• d1wvid_ appears in SCOP 1.73
  
• d1wvid_ appears in the current release, SCOPe 2.08