![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.108: HAD-like [56783] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
![]() | Superfamily c.108.1: HAD-like [56784] (26 families) ![]() usually contains an insertion (sub)domain after strand 1 |
![]() | Family c.108.1.14: NagD-like [102317] (7 proteins) duplication: consists of two segment-swapped domains of this fold; this results in the insertion of a circularly permuted domain after strand 3, analogously to the Cof family |
![]() | Protein Putative phosphatase SMU.1415c [117507] (1 species) |
![]() | Species Streptococcus mutans [TaxId:1309] [117508] (1 PDB entry) Uniprot Q8DTD6 |
![]() | Domain d1wvic_: 1wvi C: [114917] Structural genomics target |
PDB Entry: 1wvi (more details), 2.3 Å
SCOPe Domain Sequences for d1wvic_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wvic_ c.108.1.14 (C:) Putative phosphatase SMU.1415c {Streptococcus mutans [TaxId: 1309]} tykgylidldgtiykgkdripagedfvkrlqerqlpyilvtnnttrtpemvqemlatsfn iktpletiytatlatidymndmkrgktayvigetglkkavaeagyredsenpayvvvgld tnltyekltlatlaiqkgavfigtnpdlniptergllpgagailfllekatrvkpiiigk peavimnkaldrlgvkrheaimvgdnyltditagikndiatllvttgftkpeevpalpiq pdfvlsslaewdf
Timeline for d1wvic_: