SCOPe 2.08: Domain d1wvib_: 1wvi B:

Lineage for d1wvib_ (1wvi B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.108: HAD-like [56783] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.108.1: HAD-like [56784] (26 families)
   usually contains an insertion (sub)domain after strand 1

5. Family c.108.1.14: NagD-like [102317] (7 proteins)
   duplication: consists of two segment-swapped domains of this fold; this results in the insertion of a circularly permuted domain after strand 3, analogously to the Cof family

6. Protein Putative phosphatase SMU.1415c [117507] (1 species)

7. Species Streptococcus mutans [TaxId:1309] [117508] (1 PDB entry)
   Uniprot Q8DTD6

8. Domain d1wvib_: 1wvi B: [114916]
   Structural genomics target

Details for d1wvib_

PDB Entry: 1wvi, 2.3 Å

PDB Description: crystal structure of putative phosphatase from streptococcus mutans ua159

PDB Compounds: (B:) putative phosphatases involved in N-acetyl-glucosamine catabolism

SCOPe Domain Sequences for d1wvib_:

Sequence; same for both SEQRES and ATOM records:

>d1wvib_ c.108.1.14 (B:) Putative phosphatase SMU.1415c {Streptococcus mutans [TaxId: 1309]}
tykgylidldgtiykgkdripagedfvkrlqerqlpyilvtnnttrtpemvqemlatsfn
iktpletiytatlatidymndmkrgktayvigetglkkavaeagyredsenpayvvvgld
tnltyekltlatlaiqkgavfigtnpdlniptergllpgagailfllekatrvkpiiigk
peavimnkaldrlgvkrheaimvgdnyltditagikndiatllvttgftkpeevpalpiq
pdfvlsslaewdf

Timeline for d1wvib_:

• d1wvib_ first appeared in SCOP 1.71
  
• d1wvib_ appears in SCOPe 2.07