Lineage for d1wv4a_ (1wv4 A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2063731Fold b.45: Split barrel-like [50474] (3 superfamilies)
    barrel; n=6, S=10; greek-key
  4. 2063732Superfamily b.45.1: FMN-binding split barrel [50475] (5 families) (S)
    related to the ferredoxin reductase-like FAD-binding domain
  5. 2063733Family b.45.1.1: PNP-oxidase like [50476] (17 proteins)
  6. 2063818Protein Pyridoxine 5'-phoshate oxidase (PNP oxidase) [50479] (6 species)
    elaborated with additional secondary structures; active as dimer
  7. 2063822Species Escherichia coli [TaxId:562] [50481] (7 PDB entries)
    Uniprot P28225
  8. 2063829Domain d1wv4a_: 1wv4 A: [114912]
    complexed with fmn, po4

Details for d1wv4a_

PDB Entry: 1wv4 (more details), 2.6 Å

PDB Description: x-ray structure of escherichia coli pyridoxine 5'-phosphate oxidase in tetragonal crystal form
PDB Compounds: (A:) Pyridoxamine 5'-phosphate oxidase

SCOPe Domain Sequences for d1wv4a_:

Sequence, based on SEQRES records: (download)

>d1wv4a_ b.45.1.1 (A:) Pyridoxine 5'-phoshate oxidase (PNP oxidase) {Escherichia coli [TaxId: 562]}
ahlrreytkgglrrrdlpadpltlferwlsqaceakladptamvvatvdehgqpyqrivl
lkhydekgmvfytnlgsrkahqiennprvsllfpwhtlerqvmvigkaerlstlevmkyf
hsrprdsqigawvskqssrisargileskflelkqkfqqgevplpsfwggfrvsleqief
wqggehrlhdrflyqrendawkidrlap

Sequence, based on observed residues (ATOM records): (download)

>d1wv4a_ b.45.1.1 (A:) Pyridoxine 5'-phoshate oxidase (PNP oxidase) {Escherichia coli [TaxId: 562]}
ahlrreytkgglrrrdlpadpltlferwlsqaceakladptamvvatvdehgqpyqrivl
lkhydekgmvfytnlgsrkahqiennprvsllfpwhtlerqvmvigkaerlstlevmkys
fwggfrvsleqiefwqggehrlhdrflyqrendawkidrlap

SCOPe Domain Coordinates for d1wv4a_:

Click to download the PDB-style file with coordinates for d1wv4a_.
(The format of our PDB-style files is described here.)

Timeline for d1wv4a_: