Lineage for d1wv4a_ (1wv4 A:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 561372Fold b.45: FMN-binding split barrel [50474] (1 superfamily)
    barrel; n=6, S=10; greek-key
  4. 561373Superfamily b.45.1: FMN-binding split barrel [50475] (2 families) (S)
    related to the ferredoxin reductase-like FAD-binding domain
  5. 561374Family b.45.1.1: PNP-oxidase like [50476] (6 proteins)
  6. 561398Protein Pyridoxine 5'-phoshate oxidase (PNP oxidase) [50479] (5 species)
    elaborated with additional secondary structures; active as dimer
  7. 561402Species Escherichia coli [TaxId:562] [50481] (7 PDB entries)
  8. 561409Domain d1wv4a_: 1wv4 A: [114912]

Details for d1wv4a_

PDB Entry: 1wv4 (more details), 2.6 Å

PDB Description: x-ray structure of escherichia coli pyridoxine 5'-phosphate oxidase in tetragonal crystal form

SCOP Domain Sequences for d1wv4a_:

Sequence, based on SEQRES records: (download)

>d1wv4a_ b.45.1.1 (A:) Pyridoxine 5'-phoshate oxidase (PNP oxidase) {Escherichia coli}
ahlrreytkgglrrrdlpadpltlferwlsqaceakladptamvvatvdehgqpyqrivl
lkhydekgmvfytnlgsrkahqiennprvsllfpwhtlerqvmvigkaerlstlevmkyf
hsrprdsqigawvskqssrisargileskflelkqkfqqgevplpsfwggfrvsleqief
wqggehrlhdrflyqrendawkidrlap

Sequence, based on observed residues (ATOM records): (download)

>d1wv4a_ b.45.1.1 (A:) Pyridoxine 5'-phoshate oxidase (PNP oxidase) {Escherichia coli}
ahlrreytkgglrrrdlpadpltlferwlsqaceakladptamvvatvdehgqpyqrivl
lkhydekgmvfytnlgsrkahqiennprvsllfpwhtlerqvmvigkaerlstlevmkys
fwggfrvsleqiefwqggehrlhdrflyqrendawkidrlap

SCOP Domain Coordinates for d1wv4a_:

Click to download the PDB-style file with coordinates for d1wv4a_.
(The format of our PDB-style files is described here.)

Timeline for d1wv4a_: