SCOPe 2.08: Domain d1wv4a_: 1wv4 A:

Lineage for d1wv4a_ (1wv4 A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.45: Split barrel-like [50474] (3 superfamilies)
   barrel; n=6, S=10; greek-key

4. Superfamily b.45.1: FMN-binding split barrel [50475] (5 families)
   related to the ferredoxin reductase-like FAD-binding domain

5. Family b.45.1.1: PNP-oxidase like [50476] (17 proteins)

6. Protein Pyridoxine 5'-phoshate oxidase (PNP oxidase) [50479] (6 species)
   elaborated with additional secondary structures; active as dimer

7. Species Escherichia coli [TaxId:562] [50481] (7 PDB entries)
   Uniprot P28225

8. Domain d1wv4a_: 1wv4 A: [114912]
   complexed with fmn, po4
   has additional insertions and/or extensions that are not grouped together

Details for d1wv4a_

PDB Entry: 1wv4, 2.6 Å

PDB Description: x-ray structure of escherichia coli pyridoxine 5'-phosphate oxidase in tetragonal crystal form

PDB Compounds: (A:) Pyridoxamine 5'-phosphate oxidase

SCOPe Domain Sequences for d1wv4a_:

Sequence, based on SEQRES records:

>d1wv4a_ b.45.1.1 (A:) Pyridoxine 5'-phoshate oxidase (PNP oxidase) {Escherichia coli [TaxId: 562]}
ahlrreytkgglrrrdlpadpltlferwlsqaceakladptamvvatvdehgqpyqrivl
lkhydekgmvfytnlgsrkahqiennprvsllfpwhtlerqvmvigkaerlstlevmkyf
hsrprdsqigawvskqssrisargileskflelkqkfqqgevplpsfwggfrvsleqief
wqggehrlhdrflyqrendawkidrlap

Sequence, based on observed residues (ATOM records):

>d1wv4a_ b.45.1.1 (A:) Pyridoxine 5'-phoshate oxidase (PNP oxidase) {Escherichia coli [TaxId: 562]}
ahlrreytkgglrrrdlpadpltlferwlsqaceakladptamvvatvdehgqpyqrivl
lkhydekgmvfytnlgsrkahqiennprvsllfpwhtlerqvmvigkaerlstlevmkys
fwggfrvsleqiefwqggehrlhdrflyqrendawkidrlap

Timeline for d1wv4a_:

• d1wv4a_ first appeared in SCOP 1.71
  
• d1wv4a_ appears in SCOPe 2.07