Lineage for d1wuwb_ (1wuw B:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3033197Fold g.13: Crambin-like [57428] (1 superfamily)
    disulfide-rich alpha+beta fold
  4. 3033198Superfamily g.13.1: Crambin-like [57429] (1 family) (S)
    automatically mapped to Pfam PF00321
  5. 3033199Family g.13.1.1: Crambin-like [57430] (10 proteins)
  6. 3033241Protein Hordothionin [118247] (1 species)
  7. 3033242Species Barley (Hordeum vulgare) [TaxId:4513] [118248] (1 PDB entry)
    Uniprot P21742 28-72
  8. 3033244Domain d1wuwb_: 1wuw B: [114909]
    complexed with ser, tsu

Details for d1wuwb_

PDB Entry: 1wuw (more details), 1.9 Å

PDB Description: crystal structure of beta hordothionin
PDB Compounds: (B:) Beta-hordothionin

SCOPe Domain Sequences for d1wuwb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wuwb_ g.13.1.1 (B:) Hordothionin {Barley (Hordeum vulgare) [TaxId: 4513]}
ksccrstlgrncynlcrvrgaqklcanacrckltsglkcpssfpk

SCOPe Domain Coordinates for d1wuwb_:

Click to download the PDB-style file with coordinates for d1wuwb_.
(The format of our PDB-style files is described here.)

Timeline for d1wuwb_: