Lineage for d1wuwa_ (1wuw A:)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2260047Fold g.13: Crambin-like [57428] (1 superfamily)
    disulfide-rich alpha+beta fold
  4. 2260048Superfamily g.13.1: Crambin-like [57429] (1 family) (S)
    automatically mapped to Pfam PF00321
  5. 2260049Family g.13.1.1: Crambin-like [57430] (10 proteins)
  6. 2260091Protein Hordothionin [118247] (1 species)
  7. 2260092Species Barley (Hordeum vulgare) [TaxId:4513] [118248] (1 PDB entry)
    Uniprot P21742 28-72
  8. 2260093Domain d1wuwa_: 1wuw A: [114908]
    complexed with ser, tsu

Details for d1wuwa_

PDB Entry: 1wuw (more details), 1.9 Å

PDB Description: crystal structure of beta hordothionin
PDB Compounds: (A:) Beta-hordothionin

SCOPe Domain Sequences for d1wuwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wuwa_ g.13.1.1 (A:) Hordothionin {Barley (Hordeum vulgare) [TaxId: 4513]}
ksccrstlgrncynlcrvrgaqklcanacrckltsglkcpssfpk

SCOPe Domain Coordinates for d1wuwa_:

Click to download the PDB-style file with coordinates for d1wuwa_.
(The format of our PDB-style files is described here.)

Timeline for d1wuwa_: