Lineage for d1wuwa_ (1wuw A:)

  1. Root: SCOP 1.71
  2. 621190Class g: Small proteins [56992] (79 folds)
  3. 623130Fold g.13: Crambin-like [57428] (1 superfamily)
    disulfide-rich alpha+beta fold
  4. 623131Superfamily g.13.1: Crambin-like [57429] (1 family) (S)
  5. 623132Family g.13.1.1: Crambin-like [57430] (9 proteins)
  6. 623157Protein Hordothionin [118247] (1 species)
  7. 623158Species Barley (Hordeum vulgare) [TaxId:4513] [118248] (1 PDB entry)
  8. 623159Domain d1wuwa_: 1wuw A: [114908]

Details for d1wuwa_

PDB Entry: 1wuw (more details), 1.9 Å

PDB Description: crystal structure of beta hordothionin

SCOP Domain Sequences for d1wuwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wuwa_ g.13.1.1 (A:) Hordothionin {Barley (Hordeum vulgare)}
ksccrstlgrncynlcrvrgaqklcanacrckltsglkcpssfpk

SCOP Domain Coordinates for d1wuwa_:

Click to download the PDB-style file with coordinates for d1wuwa_.
(The format of our PDB-style files is described here.)

Timeline for d1wuwa_: